UCSD NHLBI Program

Sympathetic Neuroeffector Junctions and Blood Pressure


Usage of phred, phrap, consed, polyphred

for SNPs and Polymorphisms


| Home | Program | HumChroms | MouseChroms | SNPs |


This page contains instructions for usage the programs phred, phrap, consed, and polyphred for SNP and polymorphism determination from ABI DNA sequencing chromat files.

Additional information is provided for the basic Unix commands needed and for setting up of needed programs on Macintosh computers, namely, use of OS X Unix programs (telnet, rlogin, ssh, ftp, and X11) on Mac OS X computers, and use of NCSA Telnet, Fetch for ftp file transfer, and MacX for X-windows emulation on Mac OS 9 or earlier computers.

Material relevant to Mac OS X computers was added in May, 2003, in a major revision of this document.

Topics:

0. Caveats
A. Programs and Documentation
B. Basics and Summary of Program Use
C. Use of Programs on the Unix Sun Ultra10 computer 'elcapitan'
D. Needed or Useful Unix Commands
E. Use of phred, phrap, consed, and polyphred
1. Accounts and login
2. Construction of needed directory structure
3. Uploading ABI chromat files
3a. Construct a *.phd file for the "Wildtype" Sequence of the Candidate Locus
4. Execution of phred and phrap, plus auxilliary programs: phredPhrap
5. Execution of consed
6. Execution of polyphred
7. Reexecution of consed
F. Subsequent Candidate Locus SNP Analysis

Appendix:

A. For Use of Mac OS X
1. telnet, rlogin, and ssh under OS X
2. ftp under OS X
3. X-Windows under OS X
a. Installation
b. Execution and Customization of Xterm
c. Xterm Connection to Second Computer
d.Execution of Xapps on Remote Computer
e.Tests of Xterm Window
B. For Use of Mac OS 9 or lower
1. NCSA Telnet
2. Fetch
3. MacX
a. Command files
b. Preferences
C. FASTA-format

 

0. Caveats

a. Parameters given for phred, phrap, and polyphred appear to work well on the limited number of testdata sets that we have used. However, there are many 'variations on a theme' here and further optimizationmay be needed for some data sets.

b. The programs run well and fast on elcapitan, a Sun Solaris Ultra10 computer. However, disk space may become an issue. If you have disk space problems, send email to Doug Smith.

c. The Appendix contains tips for setting up telnet, rlogin, ssh, ftp, and X-windows on Macintosh computers, to run phred, phrap, consed, and polyphred from Mac computers. I would be pleased to assist users using PCs, but to date have limited experience with comparable programs for PCs.

d. The following documentation may appear intimidating and long. However, running these programs is actually not difficult nor timeconsuming. I tend to write documentation that is rather verbose and detailed, perhaps overly so. However, in my experience, most documentation never answers key questions that I (or other users) have, and I try to avoid this problem as much as possible. I also find that 'a picture is worth a thousands words'.

 

A. Programs and Documentation

1. The programs:
phred, phrap, consed,
and polyphred are Unix programs from U.Wash that work as a group for analysis of new DNA sequences. They do the following:

phred: Base calling and quality assignments
phrap: Contig formation and new quality assignments
consed: Visual X-Windows graphic interface, to view and edit alignments and contigs, and to view the original traces
polyphred: find polymorphisms in phrap contigs, do quality calls, add data to phrap files to permit consed finding and visualization of polymorphism
 

2. Program Documentation:
Program developers have documentation available for those who wish more information.
We have used the following documents available on the Web:

a. Document visualization directly on the Web:

general - Brief general documentation on swat, cross_match, and phrap
release_notes - Release notes concerning swat, cross_match, and phrap
swat - Documentation on swat, a program for searching databases using a fast Smith-Waterman implementation
phred - Primary documentation on phred
repeatmasker - Documentation on repeatmasker, a program used in the phred/phrap package. Repeatmasker is a program to screen DNA sequences for repeats and low complexity DNA sequences.
phrap - Primary documentation on phrap
consed - Primary documentation on consed (does NOT contain the tutorial)
polyphred:
main site - Brief description of polyphred
poly_doc - Primary documentation on polyphred

b. Sites for downloading program documentation:

phred - Use the browser Save as text option, to save the online documentation as a text file
phrap - Use the browser Save as text option, to save the online documentation as a text file
consed - consed 9.0 documentation, including the tutorial
polyphred - Use the browser Save as text option, to save the online documentation as a text file

3. Primary References for the programs:

Kwok, P.Y., Carlson, C., Yager, T.D., Ankenar, W., and Nickerson, D.A., 1994, "Comparative analysis of human DNA variations by fluorescence-based sequencing of PCR products", Genomics 25, 615-622. [Abstract]
 
Green, P., 1994, phrap, unpublished.
Brent Ewing, LaDeana Hillier, Michael C. Wendl, and Phil Green. "Base-calling of automated sequencer traces using phred. I. Accuracy assessment." 1998. Genome Research 8:175-185. [Abstract]
 
Brent Ewing and Phil Green. "Base-calling of automated sequencer traces using phred. II. Error probabilities." 1998. Genome Research 8:186-194. [Abstract]
 
Nickerson, D.A., Tobe, V.O., and Taylor, S.L. 1997. "polyphred: automating the detection and genotyping of single nucleotide substitutions using fluorescence-based resequencing", Nucleic Acids Research, 25(14), pp. 2745 - 2751. [Abstract]
 
Nickerson, D.A, Taylor, S.L., Weiss, K.M., Clark, A.G., Hutchinson, R.G., Stengard, J., Salomaa, V., Vartiainen, E., Boerwinkle, E., and Sing, C.F. "DNA sequence diversity in a 9.7-kb region of the human lipoprotein lipase gene." Nature Genetics, 19: 233-240, 1998. [Abstract]

Gordon, D., Abajian, C., and Green, P., 1998, "
consed: A grapical tool for sequence finishing", Genome Research 8:195-202. [Abstract]
 
Rieder, M.J., Tobe, V.T., Taylor, S.L., and Nickerson, D.A., 1998, "Automating the identification of DNA variations using quality-based fluorescent resequencing: Analysis of the human mitochondrial genome", Nucleic Acids Res. 26: 967-973. [Abstract]

 

B. Basics and Summary of Program Use

1. Files and Program Execution

Input files: ABI chromat or SCF files

Order of Program execution: phred, then phrap, then consed
or:
phred, then phrap, then polyphred, then consed
or:
phred, then phrap, then consed, then polyphred, then consed

2. Summary of Program Usage, with links to details below

a. Construct directory structure on elcapitan for a new Locus or new Set of ABI chromat files:
directory for the run, containing subdirectories chromat_dir, edit_dir, phd_dir, poly_dir
b. Upload ABI chromat files to directory chromat_dir via ftp
c. Run phredPhrap from directory edit_dir
d. optionally,
run consed to examine contigs from directory edit_dir using an X windows text window.
e. Run polyphred
f. Run consed to examine contigs and polymorphisms from directory edit_dir using an X windows text window.

 

C. Use of Programs on the Unix Sun Ultra10 computer 'elcapitan'

elcapitan is a Unix machine in the Doug Smith group.
It is a server for the UCSD Hypertension Web site and houses this suite of sequence analysis programs,
as well as other programs

NOTE: Unix machines are case sensitive !!! ... be careful with your typing of commands!!
In the usage commands below, Courier New font is used for the actual Unix commands and for programs.
BE SURE to use the case indicated! ... else you will get a cryptic, meaningless error message ...
Programs are usually named using lower case only ... this convention is used here
However, some of these programs and commands have one or more CAPITAL letters!?!

 

1. Use of Local Computers to access and use the phred, phrap, etc programs
Macs and PCs can be used to access these programs. This requires programs on your local computer.

The following are some suggestions, based on my usage. Several other similar programs are available.

a. Macintosh OS 10 or later
The required programs are either already present on the Mac (telnet or ssh, ftp) or can be downloaded from the Web (X windows capability); see Appendix below.

b. Macintosh OS 9 or earlier:

1) File Transfer: Fetch
Fetch 3.0.3: use for ftp transfer of chromat files to elcap, and for downloading output files
Fetch 3.0.3 is free from Dartmouth for downloading from here
any ftp program should work here, including ftp capability of Netscape or IE

2) command line usage of Unix and other computers: NCSA Telnet
use for
phred, phrap, and polyphred, and for moving around in your elcap account
NCSA Mac Telnet 2.6 or later:
NCSA Telnet for Macs is free for the downloading here

3) X-Window usage of Unix computers: MacX
use for
consed graphics
MacX 2.0: available from Apple for $150.00 , upgrade from MacX 1.5 for $90, by calling 1-800-293-6617 ... or search for "MacX 2.0"

b. PCs

1) File Transfer
Many ftp transfer programs exist for PCs. Some of these as shareware, found on zdnet, are as follows:

FTP Express 3.1.003a
FTP Voyager 7.0
GetRight 4.1.1
FTP Control 3.0b3
LeapFTP

and many others, found via a search on 'ftp AND windows'

2) command line usage of Unix and other computers: NCSA Telnet
use for
phred, phrap, and polyphred, and for moving around in your elcap account
NCSA PC Telnet 2.3 or later:
NCSA Telnet for PCs is free for the downloading here

3) X-Window usage of Unix computers: Hummingbird Exceed
This seems to be the PC X-windows emulation package of choice.
Exceed also does ftp transfer and standard Unix text stuff that NCSA Telnet does.
I could not find a price easily at the Hummingbird Web site ...

 

 

D. Unix commands you will need to use or which are highly useful:

You need to currently use a few Unix commands to run these programs (not very many !!):

mkdir <name> ____ Make a new subdirectory of name <name>
cd <name> _______ Change current directory to subdirectory of name <name>
cd .. ___________ Go to the directory immediately above the current one
cd ______________ Go to your Login directory
pwd _____________ Shows what directory you are in currently
ls ______________ List the file contents of the directory you are in currently
ls -alF _________ More extensive list, with file sizes etc ... / indicates subdirectories, * indicates programs
more <fileName> _ Examine the contents of text file of name <fileName>, one page at a time
tail <fileName> _ Examine the contents of <fileName> FROM THE END of the file upwards
passwd __________ Unix command used to change your password
rm <fileName> ___ Delete the file of name <fileName>. BE CAREFUL HERE!!!

For additional Unix information, there are many 'Unix help' Web sites as well as many books.
One of these sites is the Basic Unix site at the University of Washington Genome Center site.

For Mac OS X, the O'Reilly book "Learning Unix for Mac OS X", by Taylor and Jepson, is useful.

 

E. Use of phred, phrap, consed, and polyphred

1. Get an account on elcapitan and login:

a. Get an Account on elcapitan
If you do not have an account on elcapitan, send email to Doug Smith
An account will be set up for you together with a Password.

b. Changing your Assigned Password
If you wish to change your password, proceed as follows:

1) Login to elcapitan using either ssh or telnet; ssh is preferable for security purposes.
See the Appendix for tips on doing this using Mac OS X or using NCSA Telnet for Mac OS 9 or for PCs
X-windows solutions can also be used here.

2) Enter your account name at the prompt:
Enter your password at the prompt:
You should get a brief message and then the elcapitan prompt:

To change your password, do at the elcapitan 'elcapitan%:' prompt:

passwd

and type in stuff in response to the prompts ...

For passwords, use a 6-8 character password easy for you to remember BUT not easy for others to guess
Do NOT use your account name, your name, the name of your sig other or ex, etc for a password
General password rules: include in your password one or more lower case AND upper case letters,
plus numbers, plus other non-alphanumeric characters, eg ?^()$#

If you change your password, please do not forget your password!

 

2. Directory structure in your account on elcapitan for these four Programs

All four of these programs either require or are easier to run with an appropriate directory structure and Naming Convention.

Subdirectories are required for each new:
1) Candidate Locus
2) Each ABI DNA sequence data run for each locus
3) Each type of file for each sequence data run (4 subdirectories for 4 types of files)

It is important logistically to be consist in the Naming Conventions for Files and for Subdirectories.

The following Subdirectory structure and Naming Conventions is one possibility that has been used at UCSD by Bruce Hamilton and coworkers:


a. Create the Main Subdirectory
or "1st Layer" with name: <LocusName>
where <LocusName> is your favorite name for the Candidate Locus under analysis, eg ADRA1B

Do (type in and do 'return') at the prompt:

mkdir <LocusName>

This subdirectory need be created only once ...


b. Create Subdirectories
within <LocusName> subdirectory for each DNA sequence data run:
These subdirectories need to be created for EACH ABI DNA sequence data run.

Dates have been used conveniently for such Sequence Data Run Subdirectories.

EXAMPLE for data from a 96-lane run on 19 Nov 1999. do the following:
1) Enter the
<LocusName> subdirectory; do:

cd <LocusName>

2) Create the subdirectory; do:

mkdir 11.19.99

Thus the primary Subdirectory for the data run done on November 19, 1999, is:

11.19.99


c. Create Four Subdirectories within each Run Subdirectory

The four Subdirectories
chromat_dir, edit_dir, phd_dir, poly_dir must be created for each DNA sequence data run.

EXAMPLE for the 19nov99 run:

1) Enter the 11.19.99 subdirectory; do:

cd 11.19.99

2) Create the four subdirectories; do four operations at the 'elcapitan %:' prompt:

mkdir chromat_dir
mkdir edit_dir
mkdir phd_dir
mkdir poly_dir

EXAMPLE directory structure for two runs on 19 and 23 nov99 for gene ADRA1B:

You can move directly from your Login Directory to any other directory using the cd command.
For example, to go to the
edit_dir of the ADRA1B 23nov99 run from your Home Directory, do:

cd ADRA1B/11.23.99/edit_dir

 

3. Upload ABI chromat files to the chromat_dir subdirectory for the particular ABI run

Use Mac OS X ftp or Fetch or similar ... select the appropriate chromat_dir subdirectory ... transfer the files
See the Appendix below for tips on using
ftp and Fetch ...

 

3a. Construct a *.phd file for the "Wildtype" Sequence of the Candidate Locus

When polyphred is used here for SNP and polymorphism determination, it is most useful to have the "wildtype" sequence available for comparison and to provide a "backbone" for the multiple sequence alignment. What is needed is a *.phd file for this sequence. To generate and use such a file, do the following:


a. Retrieve the "wildtype" DNA sequence as a FASTA-formatted Sequence File

from an appropriate DNA database, e.g. using Entrez at GenBank.

This sequence wants to contain somewhat more than the sequences that are being re-sequenced.
However, limit the size of this sequence to no more than about 30,000 bp.

Retrieve this sequence as a FASTA-formatted file, or convert what you have retrieved to a FASTA-formatted file.
FASTA-format is described here in Appendix C.

Name the file containing the FASTA-formatted sequence as: <LocusName>.fasta
where
<LocusName> is the name for the Candidate Locus you used in setting up your Directory Structure.


b. Move this FASTA-formatted Sequence to the Locus Main Subdirectory

A convenient Subdirectory for this
<LocusName>.fasta file is in the "1st Layer" or Main Subdirectory for analysis of this Candidate Locus, namely subdirectory <LocusName>

If you retrieved the GenBank FASTA-formatted file to a computer other than elcapitan, use Fetch or other ftp program to transfer the file to subdirectory <LocusName>.


c. Convert the FASTA-formatted Sequence to a PHD-formatted Sequence File

Use the Perl script
fasta2Phd.perl to convert the <LocusName>.fasta file to a <LocusName>.phd.1 file.
Do at the prompt:

fasta2Phd.perl <LocusName>.fasta

This will automatically create an Output File of name <LocusName>.phd.1 containing the candidate locus sequence in phd-format.


d. Copy this PHD-formatted File to each of the
phd_dir Subdirectories for the Locus

This
<LocusName>.phd.1 file must be used in the phred, phrap, consed, polyphred analysis of each Run.
The file thus must be present in each and every
phd_dir used.

1) Move to the Locus Main Subdirectory
Go to the Main Subdirectory for this Candidate Locus, subdirectory
<LocusName> if you are not there.
Do at the prompt:

cd ../<LocusName>

The .. in Unix moves you to the subdirectory immediately above your currect subdirectory in the Unix directory heirarchy ... and you move then from there.

2) Copy (cp command) the <LocusName>.phd.1 file to a new phd_dir subdirectory.
For example, for the 19nov99 run for this Candidate Locus
<LocusName>.phd.1, do:

cp <LocusName>.phd.1 11.19.99/phd_dir/

This "backbone" or Control Wildtype Sequence will then be included in the subsequent contig analysis.

 

 

4. Execution of phred and phrap: phredPhrap Script

a. Move to the edit_dir for the appropriate run
You can do this in many ways, depending on which subdirectory you are in currently.
A general way to do this is to return to your Login directory, and then cd down to the
edit_dir:

1) to return to your Login directory, do at the prompt:

cd

2) to go to the edit_dir, eg for the 19nov99 run for candidate locus <LocusName>, do:

cd <LocusName>/11.19.99/edit_dir

These two commands can be combined in the single command:

cd ../<LocusName>/11.19.99/edit_dir

3) at any time, you can see what subdirectory you are in by doing:

pwd


b. Run the Perl script phredPhrap
This executes
RepeatMasker, phred, phrap, one after the other

1) do at the prompt IN THE appropriate edit_dir subdirectory for your Candidate Locus:

phredPhrap -ace -minmatch 40 -forcelevel 0

You will see a lot of messages come up to the screen as the programs execute ...

Once finished, examine your new files; do:

ls

You should see something like:

     elcapitan% cd edit_dir
     elcapitan% ls
     03.28.01.contigs                     03.28.01.fasta.screen.problems.qual
     03.28.01.fasta                       03.28.01.fasta.screen.qual
     03.28.01.fasta.log                   03.28.01.fasta.screen.singlets
     03.28.01.fasta.screen                03.28.01.fasta.screen.view
     03.28.01.fasta.screen.ace.1          03.28.01.newtags
     03.28.01.fasta.screen.contigs        03.28.01.phrap.out
     03.28.01.fasta.screen.contigs.qual   03.28.01.screen.out
     03.28.01.fasta.screen.log            03.28.01NewChromats.fof
     03.28.01.fasta.screen.polyphred.out  03.28.01_to_alu.cross
     03.28.01.fasta.screen.problems


To examine the contents of any file of name
<fileName>, do:

more <fileName>

more brings up the contents of the file to the screen, one page at a time
Scroll to the next page by pressing the
space bar on your keypad
To stop the file examination, press the
Q key on your keypad

 

5. Execution of consed

Note: If you are doing SNP / Polymorphism work, you can skip Step 5 here and go immediately to Step 6, the running of PolyPhred. Step 7 is then the subsequent use of Consed and is largely a repeat of this Step 5.

To visually examine the contigs formed by phrap, and the quality of alignments, run consed

This must be from a program that can emulate X-windows, eg X windows for Mac OS X, MacX for Mac OS 9 or earlier, or Exceed for a PC


a. Start X-Windows from your Computer

If configured correctly, you should directly logon to elcapitan and get a text-based window similar to the one you get from Telnet.

Instructions for setting up an X windows Xterm window from a Mac OS X computer are provided in Appendix A3, and for MacX from a Mac OS 9 or earlier are provided in Appendix B3.

 

b. Move to the edit_dir for the appropriate run if you are not already there
You can do this in many ways, depending on which subdirectory you are in currently.
A general way to do this is to return to your Login directory, and then cd down to the
edit_dir:

1) to return to your Login directory, do at the prompt:

cd

2) to go to the edit_dir, eg for the 19nov99 run for candidate locus <LocusName>, do:

cd <LocusName>/11.19.99/edit_dir

These two commands can be combined in the single command:

cd ../<LocusName>/11.19.99/edit_dir

3) at any time, you can see what subdirectory you are in by doing:

pwd


c. Run consed
At the elcapitan prompt in the X windows text window, do:

consed

Note: For Mac OS X, follow the instructions in Appendix A3 regarding the xhost command.

If all is well, you will get some graphics windows appearing on your computer screen.

You can now proceed to look at your data using consed.

 

d. Learning how to use consed
consed
is well described in the consed README documentation, which is available on elcapitan.

To examine this documentation one page at a time, type the following command at the 'elcapitan%' prompt in your elcapitan connection window (X windows, terminal, telnet window):

more /usr/local/bin/README.consed

You can also get a copy of this documentation into your own account by typing from your account directory:

cp /usr/local/bin/README.consed .

NOTE the period . in the above command ... most important!

You can of course also download this file via ftp and print it out ... or whatever.

 

e. Run the consed Tutorial from the consed README documentation
It is most worthwhile to do some of the "Quick Tour of consed" tutorial that is found in the
consed README documentation. Spending an hour or two on this tutorial will save you time later.

The easiest way to do this is to have TWO connections to elcapitan at the same time, and then do:

1) execute the commands in the tutorial from an X windows connection ... and ...

2) simultaneously read the Tutorial information from the README documentation using a second connection to elcapitan. This can be done using any connection (X windows, Terminal, NCSA Telnet, etc).

Although you can run the tutorial on your own data, it is more convenient to use the standard test data provided with consed since some of the tutorial examples apply directly to these standard test data.

To then do this using the consed standard test data, do the following:

1) Turn on X windows and get an X windows text window (xterm, MacX, eXceed, etc)

2) Type the following two commands at the 'elcapitan%' prompt in your X windows window:

cd /usr/local/bin/standard/edit_dir
consed

The first command takes you to the edit_dir containing the *.ace file for the polyphred test data.
The second command executes
consed, and brings up the standard test data used in the tutorial.

You are now ready to execute the commands in the tutorial using this X windows window.

Note: go through the first part of the tutorial that deals with consed distribution, installation, and turning on consed ... Distribution and installation has been done by us, and you already have turned on consed.

Begin where the tutorial says: "Two windows will appear. ..."

3) To simultaneously read the information on what to do to run the tutorial from the consed README documentation, open a SECOND connection to elcapitan. This can be a second X windows window, or a Terminal window on a Mac OS X computer, or a NCSA Telnet window.

4) Log on to elcapitan from this second window, and bring up the consed README documentation by doing at the 'elcapitan%' prompt:

more /usr/local/bin/README.consed

Click on the space bar or on the <return> key to move down to the 'Quick Tour of consed' tutorial part of the documentation (the space bar moves one page at a time, the <return> key moves one line at a time, through the document displayed via the more command).

5) Read the tutorial in this second window and execute the tutorial commands in your first, X windows window.

 


f. To Sort the Chromatogram "Reads" before running consed:
If you wish to sort the reads before running
consed, do the following:

1) Turn on consed, but BEFORE opening the .ace file, go to the consed Main Menu.

2) Under options, choose general preferences.

3) The eleventh selection says Display reads sorted alphabetically or by strand/left read end; click on alpha, and then click on apply and dismiss.

4) Now open the *.ace file and proceed as usual.

The chromatograms will now be sorted alphabetically (or numerically).
Experience at UCSD has shown this to be a useful option.

 

g. Shutting down consed
Use the Quit command from the consed Main Menu to shut down consed

After using consed and quitting, return to your Home directory on elcapitan by typing in the X windows text window:

cd

to bring you back to your Home directory.

 

 

6. Execution of polyphred

Now find polymorphisms in your contigs and add appropriate tags to the data files via polyphred.
polyphred
is most conveniently run from the edit_dir directory for the run of interest.


a. Enter the
edit_dir for the appropriate run

You can do this in many ways, depending on which subdirectory you are currently in.
A general way to do this is to return to your Login directory, and then
cd down to the edit_dir:

1) to return to your Login directory, do at the prompt:

cd

2) to go to the edit_dir, eg for the 19nov99 run, do:

cd snps/11.19.99/edit_dir

3) at any time, you can see what subdirectory you are in by doing:

pwd



b. Use Telnet and text commands to run polyphred
The text window in MacX can also be used to run polyphred.



c. Run polyphred

Example for the 19nov99 data run; do at the elcapitan prompt in Telnet and the edit_dir directory:

polyphred -ace *.ace.1 -tag p > *.polyphred.out

where *.ace.1 is the .ace file present in the edit_dir subdirectory.

Example of such a *.fasta.screen.ace.1 filename:

11.19.99.fasta.screen.ace.1

Note: this command will give polymorphisms of quality 'ranks' 1 through 3
1 is the highest quality, 6 is the lowest quality


The qualifier
-tag p is used to list the tagged polymorphisms in the polyphred output file *.polyphred.out.

To see ALL polymorphisms (qualities 1-6), add the -rank 6 option in the above command:

polyphred -ace *.ace.1 -tag g -tag p -rank 6 > *.polyphred.out

Polymorphisms of ranks 4, 5, or 6 are very seldom real, as is true also of many of rank 2 or 3 ...

 

 

d. Results:

1. Lots of messages will come up to the screen as polyphred does its thing ...
2.
polyphred writes output to your output file; for the above, file:

11.19.99.polyphred.out

3. polyphred also MODIFIES the *.fasta.screen.ace file, the *.phd files in the phd_dir directory for sequences with polymorphisms, and the *.poly files in the poly_dir directory for sequences with polymorphisms.



e. Examine Polymorphisms found by polyphred
To see via text display the polymorphisms found by
polyphred:

1) Examine the contents of the polyphred output file, eg:

11.19.99.polyphred.out

Do:

more 11.19.99.polyphred.out

Continue examination until you come to the section beginning with:

BEGIN_POLY

Examine these data to the end of this section:

END_POLY

These data show position of polymorphism in a contig, 5' and 3' sequences, the SNP, and quality of the polymorphism.

EXAMPLE of such data:

Posn                 5'seq                                       SNP                          3'seq                    Quality
BEGIN_POLY
93        GTGGTCGGT             A       G       TGTTCATCT          6
137       TCTACCGCT             T       C       GGTAAGTTG          6
138       CTACCGCTT             G       T       GTAAGTTGG          6
139       TACCGCTTG             G       T       TAAGTTGGG          6
145       TTGGTAAGT             A       T       GGGGACTAG          2
147       GGTAAGTTG             G       A       GGACTAGCA          6
148       GTAAGTTGG             G       A       GACTAGCAG          6
160       CTAGCAGCA             G       C       GGGGACTGG          6
170       GGGGACTGG             G       A       CATTTTTGG          6
186       TGGACCTTG             G       A       GTTTACTGA          6
189       ACCTTGGGT             T       G       TACTGATGA          6
193       TGGGTTTAC             T       A       GATGAGCTT          6
209       CTTACTCTA             A       C       AGTTTTTTG          6
216       TAAAGTTTT             T       G       TGTGGGTTT          6
225       TTGTGGGTT             T       G       TGTTTCTTA          6
239       TCTTATGCA             G       A       TCTGTGCGT          6
253       TGCGTGTTC             G       A       GAGATTGAA          6
259       TTCGGAGAT             T       A       GAATAATAT          6
272       TAATATTGT             A       T       TGTTCTGCA          2
273       AATATTGTT             T       C       GTTCTGCAA          6
281       TTGTTCTGC             A       T       AAGGGTTTG          6
282       TGTTCTGCA             A       C       AGGGTTTGC          6
283       GTTCTGCAA             C       A       GGGTTTGCA          1
293       GGGTTTGCA             G       T       ATTGGGGAG          2
298       TGCAGATTG             G       A       GGAGCTGGC          6
306       GGGGAGCTG             G       A       CTAAAAACC          6
311       GCTGGCTAA             A       C       AACCAACTC          6
332       GTGTTAGTA             G       A       AACACGCTA          6
350       AAGGCACTA             G       T       CTTCTGGAA          6
363       CTGGAAATA             G       C       AACCAGGGA          6
389       TCTGGTATG             A       G       GGAATGACT          2
390       CTGGTATGA             G       T       GAATGACTC          6
427       AATAATTAA             A       G       AAGGATATT          6
438       AGGATATTC             A       G       CTGGGCTTG          6
END_POLY

The above data include Quality Ranks of ALL levels (1-6). Normally you will have only qualities of 1-3, and it is the experience of workers that Quality 3 is seldom real, Quality 2 is sometimes real, and Quality 1 is usually but not always real.

Consed must be used to examine visually the ABI chromatogram characteristices for each potential Polymorphism to decide if a given polymorphism is "real' ... this should be done by at least two different personnel.
This is described in more detail below.

Annotations or comments can be made to the above file to designate decisions made concerning potential polymorphisms. Alternatively, COPY-PASTE can be used to move the above data to a Word file for subsequent annotation.


f. Modifications in the
phrap Files made by polyphred:

To see via text display modifications in the
phrap files made by polyphred:

1) Examine the END of the contents of, eg, the *.fasta.screen.ace file,
EXAMPLE of such a file:

11.19.99.fasta.screen.ace.1

Do:

cat 11.19.99.fasta.screen.ace.1

or do:

tail -500 11.19.99.fasta.screen.ace.1

and examine modifications such as the following at the end of the file:

CT{
Contig2 polymorphism polyPhred 106 106 1000106:205257
}
CT{
Contig2 polymorphism polyPhred 150 150 1000106:205257
}
CT{
Contig2 polymorphism polyPhred 151 151 1000106:205257
}

 

 

7. Reexecution of consed

If all went well with polyphred, you will now be able to visualize the polymorphisms using consed.

This must be from an X windows text window (Xterm, MacX, eXceed, etc).


a. Start X-Windows from your Computer

If configured correctly, you should directly logon to elcapitan and get a text-based window similar to the one you get from Telnet.

Instructions for setting up an X windows Xterm window from a Mac OS X computer are provided in Appendix A3, and for MacX from a Mac OS 9 or earlier are provided in Appendix B3.

 

b. Move to the edit_dir for the appropriate run if you are not already there
You can do this in many ways, depending on which subdirectory you are in currently.
A general way to do this is to return to your Login directory, and then cd down to the
edit_dir:

1) to return to your Login directory, do at the prompt:

cd

2) to go to the edit_dir, eg for the 19nov99 run for candidate locus <LocusName>, do:

cd <LocusName>/11.19.99/edit_dir

These two commands can be combined in the single command:

cd ../<LocusName>/11.19.99/edit_dir

3) at any time, you can see what subdirectory you are in by doing:

pwd


c. Run consed
At the elcapitan prompt in the X windows text window, do:

consed

Note: For Mac OS X, follow the instructions in Appendix A3 regarding the xhost command.

If all is well, you will get some graphics windows appearing on your computer screen.

You can now proceed to look at your data using consed.

 

d. Learning how to use consed
consed
is well described in the consed README documentation, which is available on elcapitan.

To examine this documentation one page at a time, type the following command at the 'elcapitan%' prompt in your elcapitan connection window (X windows, terminal, telnet window):

more /usr/local/bin/README.consed

You can also get a copy of this documentation into your own account by typing from your account directory:

cp /usr/local/bin/README.consed .

NOTE the period . in the above command ... most important!

You can of course also download this file via ftp and print it out ... or whatever.

 

e. Run the consed Tutorial from the consed README documentation
It is most worthwhile to do some of the "Quick Tour of consed" tutorial that is found in the
consed README documentation. Spending an hour or two on this tutorial will save you time later.

The easiest way to do this is to have TWO connections to elcapitan at the same time, and then do:

1) execute the commands in the tutorial from an X windows connection ... and ...

2) simultaneously read the Tutorial information from the README documentation using a second connection to elcapitan. This can be done using any connection (X windows, Terminal, NCSA Telnet, etc).

Although you can run the tutorial on your own data, it is more convenient to use the standard test data provided with consed since some of the tutorial examples apply directly to these standard test data.

To then do this using the consed standard test data, do the following:

1) Turn on X windows and get an X windows text window (xterm, MacX, eXceed, etc)

2) Type the following two commands at the 'elcapitan%' prompt in your X windows window:

cd /usr/local/bin/standard/edit_dir
consed

The first command takes you to the edit_dir containing the *.ace file for the polyphred test data.
The second command executes
consed, and brings up the standard test data used in the tutorial.

You are now ready to execute the commands in the tutorial using this X windows window.

Note: go through the first part of the tutorial that deals with consed distribution, installation, and turning on consed ... Distribution and installation has been done by us, and you already have turned on consed.

Begin where the tutorial says: "Two windows will appear. ..."

3) To simultaneously read the information on what to do to run the tutorial from the consed README documentation, open a SECOND connection to elcapitan. This can be a second X windows window, or a Terminal window on a Mac OS X computer, or a NCSA Telnet window.

4) Log on to elcapitan from this second window, and bring up the consed README documentation by doing at the 'elcapitan%' prompt:

more /usr/local/bin/README.consed

Click on the space bar or on the <return> key to move down to the 'Quick Tour of consed' tutorial part of the documentation (the space bar moves one page at a time, the <return> key moves one line at a time, through the document displayed via the more command).

5) Read the tutorial in this second window and execute the tutorial commands in your first, X windows window.

 

f. consed Output related to Polymorphisms
To examine the
consed presentation related to polymorphisms, do the following, as taken from the consed documentation README.consed:

consed-polyphred INTERACTION
polyphred is a program for finding polymorphic sites developed by
Debbie Nickerson's group (contact them at stay@u.washington.edu).
We have a test database, 'polyphred', which has had polyphred run on
it already. polyphred has put a polymorphism tag on each polymorphic
site.
Type:
cd ../../polyphred/edit_dir
ls
../../consed -ace example2.fasta.screen.ace.1
When consed comes up, you should see 2 contigs.
Double click on Contig2
In the Aligned Reads Window, push the left mouse button while pointing
to the 'Navigate' menu and release on
'Toggle feature: when navigating to consensus location, pop up all
traces (currently off)'
That will turn this feature on.
Now push the left mouse button while pointing to the 'Navigate' menu
and release on 'Tags'. Up should pop a list of tag types. Double
click on 'polymorphism'. polyphred has already been run so the
consensus is tagged with polymorphism tags at each polymorphic site.
Up will pop a window labelled 'Polymorphism Tags' with a list of
sites. Click on 'Next'.
If you correctly followed the instructions above, all the traces should
pop up at the first polymorphic site. You may want to reposition the
traces window to see it better.
Now ignore the original 'Polymorphism Tags' window and instead click
on 'Next' in the *traces* window. This will take you to the next
polymorphic site. Pretty nice, huh?

 

The following is similar, but based on suggestions and procedures used by Sarah Shaw:

1) in consed, call up the appropriate *.ace file and the contig.

2) under the Navigate pulldown menu, select:

Toggle feature: when navigating to consensus location,
pop up all traces (currently off).

This will turn the feature on.

3) under the Navigate pulldown menu, select:

Tags

and then select:

polymorphism

This creates a new window called polymorphism tags. This window lists all individuals who have a putative SNP, and gives the consensus location for each SNP.

4) double-click on the consensus location for a SNP in the polymorphism tags window.
This will bring up all ABI traces for each individual at this location.
Scroll through the traces and visualize each lane to determine if the SNP is real or not.
The lanes thought to have a SNP by
consed are tagged in blue.

Note: when one is evaluating the worthiness of a putative SNP via examination of ABI trace data, it is worthwhile to also open the *.polyphred.out file and make notes next to (annotate) the listed tagged polymorphisms regarding this decision process.

5) if a given SNP is determined to be "real", then genotype information for the SNP is copied from the *.polyphred.out file into a Master file for the candidate locus in Excel.

These annotation operations are also described below.

 

 

g. If you wish to SORT THE READS before running consed, do the following:

1) BEFORE opening the *.ace file, go to the consed Main Menu.

2) Under options, choose general preferences.

3) The eleventh selection says Display reads sorted alphabetically or by strand/left read end;
click on alpha, and then click on apply and dismiss.

4) Now open the *.ace file and proceed as usual.

The chromatograms will now be sorted alphabetically (or numerically).

 

h. consed tutorial using polyphred analysed data:

You can learn how to use consed on the test data mentioned in the above documention as follows:

1) Turn on X windows and get an X windows text window (xterm, MacX, eXceed, etc)

2) Type the following two commands at the 'elcapitan%' prompt in the MacX text window:

cd /usr/local/bin/polyphreddir/edit_dir
consed

The first command takes you to the edit_dir containing the *.ace file for the polyphred test data.
The second command executes
consed.

You can now do with these data in consed using X windows as suggested in the consed tutorial, as reproduced above.

After using consed and quitting, return to your Home directory on elcapitan by typing in the MacX text window:

cd

To learn how to optimally use consed in general, I highly recommend following the tutorial in the consed README documentation. You can do this as described above.

 

 

F. Subsequent Candidate Locus SNP Analysis:

The following constitutes the initial types of subsequent analysis, as described by Sarah Shaw.

 

1. Determine which potential polymorphisms are real:

This is described above and comprises the following:

1) Use of consed and visual inspection by two or more personnel of ABI chromatograms to decide if a given polymorphism is "real".

2) Annotate or add comments to the Output File *.polyphred.out or to a Word File containing the polymorphism data using COPY-PASTE operations.

 

2. Annotate further the Candidate Locus information:

Construct an Excel Master Spreadsheet for the Candidate Locus.

This file will contain at least the following:

1) Annotation on the Candidate Locus as obtained from GenBank, ExPASy, and other sources.

2) Genotypic data for each real SNP determined from the above DNA Sequencing analyses.

3) Phenotypic data from a variety of sources.

4) Further human genetic and statistical analyses.

 

 

 

Appendix:

A. For Use of Mac OS X (10.2 or higher)
The Macintosh Operating System OS X is based on the Darwin version of Unix. Thus, Unix functions needed to communicate with another Unix computer (telnet etc), to transfer files via ftp (file transfer protocol), and to run X-Windows directly as a graphics protocol on the Macintosh are either provided directly with OS X or can be obtained online, with no need for third party programs. The following briefly describes how to perform these tasks with a Mac OS X computer (OS X 10.2 or higher).

 


1.
telnet, rlogin, and ssh under OS X

The Unix functions telnet, rlogin, and ssh all can be used directly in Mac OS X to connect to, and communicate with, a second computer that supports these functions.

On a Mac computer running under OS X, these can all be used from the terminal window.
The terminal window on a Mac OS X computer is used to execute Unix commands on the Mac;
the Mac largely becomes a Unix computer.

1. Open a terminal window by executing the terminal program, found in:

/ Applications / Utilities

2. To use telnet to connect to a second computer, eg elcapitan, do at the terminal window prompt:

telnet elcapitan.ucsd.edu

and then login with Username and Password.

3. To use rlogin to connect to a second computer, eg elcapitan, do at the terminal window prompt:

rlogin elcapitan.ucsd.edu

and then login with Username and Password.

4. To use ssh to connect to a second computer, eg elcapitan, do at the terminal window prompt:

ssh -l <UserName> elcapitan.ucsd.edu

where <UserNamer> is your Username on the second computer, eg elcapitan.
Then respond with your Password.

5. With each of these connections, the terminal window is then used as a Unix text window for execution of Unix line commands.

NOTE: Of these three commands, any of which permits connection to the second computer, the ssh (Secure SHell) command is the best to use for security purposes. ssh esentially encripts your password during transit between the computers, thereby making it more difficult for hackers to obtain your password. Because of the lack of security with the telnet and rlogin commands, some computer systems, eg those at the San Diego Supercomputer Center, prohibit use of these commands and require use of ssh.

2. ftp under OS X

The Unix ftp function can also be used directly in Mac OS X , to transfer files (File Transfer Protocol) to or from a second computer that supports the ftp function.

On a Mac computer running under OS X, ftp can also be used from the terminal window.

1. Open a terminal window by executing the terminal program, found in:

/ Applications / Utilities

2. To use ftp for file transfer to or from a second computer, eg elcapitan, do at the terminal window prompt:

ftp elcapitan.ucsd.edu

and login with your UserName and Password. You should get the ftp prompt: ftp>

3. Execute appropriate ftp commands to transfer ascii or binary files to or from your Mac OS X system.
These commands are explained in any standard Unix book, or you can use the "man" facility on any Unix machine, eg from the terminal window on the Mac.
To see commands available (with no explanation of what they do), at the
ftp> prompt do:

?

4. The most important ftp commands, executed at the ftp> prompt, for file transfer are:

? _________________ Show ftp commands available
ascii _____________ Transfer subsequent files assuming they are text (ascii characters) files
binary ____________ Transfer subsequent files via binary image transfer
get <FileName> ____ Transfer the file whose name is <FileName> from the Mac to elcapitan
put <FileName> ____ Transfer the file whose name is <FileName> from elcapitan to the Mac
mget * ____________ Transfer all files in the current Mac folder from the Mac to elcapitan
mput * ____________ Transfer all files in the the current elcapitan subdirectory from elcapitan to the Mac

Notes:

1. Many standard Unix commands also work at the ftp> prompt, eg pwd, cd, dir (instead of ls), etc
2. Many possibilities exist for use of wildcard * with the mget and mput commands. Take care with ascii vs binary files.
3. It is usually easier to position yourself in the appropriate Mac folder prior to execution of the ftp command on the Mac, with then use of cd, pwd, and dir commands to position yourself in the appropriate Unix, eg elcapitan, computer subdirectory.

Final Note: Because of the Unix text-only "look and feel" of ftp as executed in the terminal window (line commands, no menus, etc), versus the Mac interactive mouse "look and feel" of Fetch (menus, shortcuts, drag and drop, etc), you may wish to use Fetch for file transfer even if you are using a Mac OS X computer!!

 

3. X-Windows under OS X

X-Windows is the standard graphics interface used by most Unix computers. It is used here by Consed to display sequence alignments, sequence features, sequencing traces, etc. Although the Mac OS X operating system supports X-windows, X-windows software does not come as a standard part of OS X. However, this software is free and available on the Web. The following describes in four Steps how to do this, how to customize your Xterm windows, and how to connect up and use Consed and other Unix graphics programs (Xapps).


a. Install X11 from Apple

The current standard version of X-windows is the X11 version, and can be downloaded for free from several Web sites. The version available at Apple is recommended (stable, clean, robust).

1) Go to Apple X11 MacOSX Web site at:

http://www.apple.com/macoxs/x11

2) Retrieve FAQ pages as learning material, store in convenient folder under Documents

3) Download X11 package (X11 Public Beta 2-12-03, based on XFree86 4.2.1) from:

http://www.apple.com/macosx/x11/download/

4) The file to download is:

X11UserForMacOSX.dmg.bin

5) Open this StuffIt bin file, get folder:

X11 User for Mac OS X

6) Move (drag and drop) this folder tot he Mac folder for OS X applications:

Applications

7) Install X11 via Basic Installation from Installer:

X11UserForMacOSX.mpkg

thereby yielding X11 as application X11:

.. / Applications / X11

 

b. Run X11 on the Mac as Xterm window and Customize your Xterm windows

To run X11, open the X11 file (doubleclick on it). This opens an xterm window, a Unix window similar to a terminal or term window except that Xapps are supported. This xterm Unix window works like all other Unix line command windows: you type in commands at the Unix xterm prompt.

1) To run standard X11 applications, just type their names at the xterm window prompt.
Examples are:

xclock & ... xlogo & ... xcalc & ... xload &

Note: The & runs the Unix application in the background, ie in a separate window, thus still giving you control over your xterm window.

2) Most of these applications are found in folder:

/ usr / X11R6 / bin

And there is more stuff in folder:

/ etc / X11

To customize your Xterm windows:
You can easily cutomize your prompt, the window size and type, lines saved for scrollback, etc.
This is done modifying the xterm command in an "init" file called .xinitrc
Init files are Unix files that are executed upon login, to set parameters for your use of the computer.
The .xinitrc file is the appropriate init file for X-window applications, including the xterm window

3) To see what can be done, type at the xterm window prompt:

xterm -Help

4) Using a Unix terminal window, copy a sample xinitrc file to your home directory as file.xinitrc; do:

i) Go to your home directory ... this is typically on a Mac OS X computer:

/ Macintosh HD / Users / <YourName>

ii) Execute the following copy (cp) command:

cp /etc/X11/xinitrc/xinitrc .xinitrc

5) Modify the xterm command in this file as desired, using vi or other Mac Unix editor.
My command looks like:

xterm -sb -sl 5000 -fs 9 -bc -geometry 100x55 &



c. Run ssh from the Xterm Window to connect to elcapitan or other Computer
This is done as described above for ssh connecting from a terminal window with the -X option.

1) To do this to connect to a second computer, eg elcapitan, do at the xterm window prompt:

ssh -X -l <UserName> elcapitan.ucsd.edu

where <UserName> is your Username on the second computer, eg elcapitan.
Then respond with your Password.

Note: You can omit this -l <UserName> option if your Username is the same on your Mac and on the second computer.

You are now logged in to the second computer just as via a terminal window, but you now have the potential to run X-windows graphics applications with display of the graphics on your Mac display.


d. Execution of X-windows Applications on Second Computer, eg elcapitan
In connecting up to a computer such as elcapitan with the purpose of running X-window applications, one must assure that the computer sends the X-window graphics back to your Mac and displays the graphics on your display screen. The only way we have successfully found to do this invokes the xhost command. This creates a security leak while on, but one need only have xhost on while turning on the X-windows application. The X application, turned on with xhost on, will continue to work with xhost off.

Note: Xforwarding must be set up on the second computer on which you wish to run the X applications. If upon doing the following, you can not get a display of an Xapp, eg xclock, on your Mac from the second computer, contact the system administrator of the second computer and ask if Xforwarding is set up.

Do the following to execute Xapps from the Second Computer:

1) Connect to the second computer, eg elcapitan, from an xterm window on the Mac using ssh as described above.

2) Open a terminal window as a second Unix window on the Mac; do NOT connect up to the second computer.

To do this, execute the terminal program, found on the Mac in:

/ Applications / Utilities

3) When ready to turn on an Xapp in the xterm window from the second computer, eg elcapitan, do the following:

i) In the terminal window on the Mac (NOT connected to the second computer !!), type at the prompt:

xhost +

You should see a response like:

access control disabled, clients can connect from any host

ii) In the xterm window on the second computer, execute one or more X applications, for example:

xclock & ... xload & ... xcalc & ... consed &

Note: The & runs the Unix application in the background, ie in a separate window, thus still giving you control over your xterm window.

iii) Finally, in the terminal window on the Mac, type at the prompt:

xhost -

You should see a response like:

access control enabled, only authorized clients can connect

This removes the security leak and the X applications in the xterm windows should still be running ...


e. Tests of xterm etc
I find xclock to be a good test of your connectivity and functionality. In particular, you might try the following:

1) Open an xterm window and turn on xclock on the Mac with a light blue background; do:

xclock -bg lightblue &

Note: to learn about options for an Xapp, eg xclock, do:

man xclock ... or ... xclock usage

2) Now connect up to a second computer, eg elcapitan, and use the xhost + / xhost - game in a Mac terminal window as described above while turning on xclock with a yellow background on elcapitan:

xclock -bg yellow &

You should now have two xclocks on your screen, the lightblue one showing the Macintosh time and the yellow one showing the time on the second computer ...

If this all works, you are pretty well set up !!!

 

 

B. For Use of Mac OS 9 or lower

The Macintosh Operating System for the PowerPC prior to OS X (OS 8-9) is not Unix based, and hence third party programs for tasks including Telnet (TCP/IP communication to a second computer, eg elcapitan), ftp (file transfer protocol; interchange of files between computers), and X-Windows (the default graphics standard used on Unix computers) emulation must be used. Typical programs for these three tasks are NCSA Telnet, Dartmouth Fetch, and Apple MacX. Set up and use of these programs is briefly described here.

1. NCSA Telnet

NCSA Telnet can be obtained for the downloading from NCSA for Macs here and for PCs here.

a. Preferences
Once installed, you need to set the Preference settings.
These can be found in the Edit pulldown Mac menu.
There are five menus: Global, Terminals, Sessions, FTP Server, FTP Users

The following are the settings I use:

1) Global settings:

 
2) Terminal settings:

You can have more than one set of Terminal settings. I use only one, as follows, accessible by clicking on the change button in the Terminal settings window:

 

3) Sessions settings:

You can have more than one set of Terminal settings. I use only one, as follows, accessible by clicking on the change button in the Terminal settings window:

 

4) FTP Server settings:

NCSA Telnet can be used for ftp file transfer. However, I prefer the DRAG and DROP capabilities of Fetch, and so do not use ftp with Telnet. However, the settings that I have for the FTP Server are as follows:

 

5) FTP Users settings:

I don't use the FTP Users capabilities of NCSA Telnet.

 

2. Dartmouth Fetch

Fetch can be obtained for the downloading from Dartmouth here.
The version as of 7 Jan 2000 is Fetch 3.0.3. Fetch comes with a good Help facility.

a. Preferences:
Once installed, you need to set the Preference settings which can be found in the Customize dropdown menu:

The Preferences popup menu has several parts:

Settings I use for each part are as follows:

1) General settings:


2) Download settings:


3) Upload settings:


4) Formats settings:


5) Firewall settings:

These are not used by me.

6) Mirrors settings:

These are not used by me.

7) Misc settings:

 

b. Shortcuts:
Shortcuts are used for rapid login to your favorite computer and directory.

Examples of Shortcuts that I use are as follows, from the Fetch File pulldown menu:

 

A given Shortcut can be selected from the Open Shortcut menu shown, or from the following popup menu obtained when you execute a New Connection... operation also shown in the menu above:

 

An example of a Shortcut is that for elcapitan among the choices above. Selecting elcapitan yields:

Clicking on ok automatically logs me into my account doug on elcapitan, and puts me in my home directory /export/home/doug, shown as follows:

 

A window comes up that shows the connection being made and retrieval of the list of files in my home directory.
You can now move down into lower subdirectories by double-clicking on any directory name in the window.

Files may be uploaded to elcapitan by simply 'dragging' their names from the appropriate Mac folder to the appropriate directory displayed in the Fetch directory window. Transfer rates and state of completion are displayed at the right in the above window. The following is an example of transfer of 96 ABI chromat files:

Files may be downloaded (get operation) by 'dragging' them from the Fetch directory window to the appropriate Mac folder. Transfer rates and state of completion are again displayed at the right in the above window.

Other operations are possible, eg uploading or downloaded all files in a folder or directory, deleting files on the computer to which you are connected, editig Shortcuts you have created, etc. See the Fetch Help facility and other Fetch pulldown menus for details.

 

3. Apple MacX

MacX 2.0 may be purchased from the UCSD bookstore or from UCSD Academic Computing Services (ACS).

Once installed, you need to set the Preference settings. MacX can be used in a variety of ways; see the MacX User Guide that comes with MacX.

The following rather simple setup has worked for me so far with little trouble (MacX does bomb sometimes ...)

a. Setting up an elcapitan Command

MacX accesses remote computers by executing a 'command', and you must create a new 'command' to access elcapitan.
Do the following:

1) Turn on MacX on your Mac

2) Click on the New Command ... option in the MacX Remote pulldown menu:

3) In the popup window that appears, type in the following information and check the appropriate boxes:

 

4) This should create for you a new Mac file in the MacX folder with an Icon that looks like:

 

Subsequently, just double-clicking on this icon should bring up MacX and directly connect you to elcapitan using the account information you provided in the Remote Command window above. You should see a Unix text window similar to that seen in NCSA Telnet that looks like the following:

5) You can now test the X-windows capabilities by typing at the 'elcapitan%' prompt:

acedb

This should bring up the Main Window of the ACeDB database DictyDB, which you can peruse as desired.


6) As another test, try consed with the standard test data that is the basis of the consed tutorial.
Type the following two commands at the 'elcapitan%' prompt:

cd /usr/local/bin/standard/edit_dir
consed

The first command takes you to the edit_dir containing the *.ace file for the polyphred test data.
The second command executes consed.

After using consed and quitting, return to your Home directory on elcapitan by typing in the MacX text window:

cd


7) As a final test, try consed with the polyphred test data ... type the following two commands at the 'elcapitan%' prompt:

cd /usr/local/bin/polyphreddir/edit_dir
consed

The first command takes you to the edit_dir containing the *.ace file for the polyphred test data.
The second command executes consed.

You can now do with these data in consed using MacX as suggested in the consed tutorial, reproduced above.

After using consed and quitting, return to your Home directory on elcapitan by typing in the MacX text window:

cd

 

 

b. MacX Preferences

You should not need to do much here, but the following are the settings I use.

1) Access the MacX Preferences in the MacX Edit pulldown menu:

2) You see that there are seven sets of Preferences
I have done nothing with the B&W Root Prefs, Color Root Prefs, and XDMCP Prefs.

For the others, I use the following:

a) Window Preferences: I use a 'growable' window style:

b) Display Preferences:

c) Misc Preferences:

Unix computers use a 3-button mouse, whereas Macs use a 1-button mouse. By default, MacX uses the single Mac mouse button for the Unix left button, a combination of the Mac left arrow key and its button for the Unix middle button, and a comination of the Mac right arrow key and its button for the Unix right button. This is what I use, as indicated in the settings in this Misc Preferences window. MacX can use other combinations; see the MacX User Guide for more information. In practice, when I need to use a Unix button other than the usual left button in MacX operations, I just try the two arrow keys until something works. The following are the Misc Preferences I use, which may not be optimal for all operations:

 

 

C. FASTA-Format

Many formats are used for DNA, RNA, and Protein Sequences. FASTA-format is commonly used, since it takes up a minimum of space but permits a brief Sequence Description in a Header Line, and has a Delimiter at the beginning of the Sequence, permitting use of Text Files containing many individual sequences.

1. Properties:
1) Header line: begins with > delimiter followed by EntryName ... no spaces
EntryName often limited to 6 or 8 or 12 characters, usually Letters or Numbers
After EntryName comes a space followed by free text: Description of entry
NOTE: this first Space is Delimiter between EntryName and entry Description ...
2) Sequence begins on line 2 and continues for as many lines as needed ...
Usually: 80 residues per line or less ... Upper or lower case permitted ... no spaces ...
standard code letters used, no numbers ... no * at end
3) No Annotation or Documentation permitted except in brief line 1 description ...

2. Delimiters:
> at beginning of Entry; none at end of Sequence; none at end of Entry

3. Examples:

a. The following is an example of a FASTA-formated protein sequence.

>CATPAA Chloramphenicol acetyltransferase (EC 2.3.1.28) - E. coli plasmids
MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFI
HILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIY
SQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQG
DKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA

b. The following is an example of a FASTA-formatted DNA sequence.

>ECOORIC E.coli K12 origin of replication
gatcctaggtattaaaaagaagatctatttatttaggagatctgttctat
tgtgatctcttattaggatcgcactgccctgtggataacaaggatccggc
ttttaagatcaacaacctggaaaggatcattaactgtgaatgatcggtga
tcctggaccgtataagctgggatcagaatgaggggttatacacaactcaa
aaactgaacaacagttgttctttggataactaccggttgatccaagcttc
ctgacagagttatccacagtagatcgcacgatctgtatacttatttgagt
aaattaacccacgatcccagccattcttctgccggatcttccggaatgtc
gtgatcaagaatgttgatcttcagtgtttcgcctgtctgttttgcaccgg
aatttttgagttctgcctcgag

 

 


| Home | Program | HumChroms | MouseChroms | SNPs |


 

Creation Date: January, 2000
Latest modification: May, 2003

If you have problems or comments, contact Doug Smith